DPCstruct | MC14679
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 150 ± 17 aa |
| Standard deviation of domain lengths | 16.65 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U8JGZ6 | 9-149 | FRDNYTRYEYSFIEFYAEPLCDLSRAFKGDMQMVLLLATVAQVALRADMIVENSGGRVQELPPSRRGITTYRLADVTGIPRETTRRK… |
| A0A0V2F6R3 | 3-140 | TDVRRAVIRLSAGYFLRSLDVAKSLHQDDPVRAIVFTTIWVANVAHIRPNAGFDAKNELAKDAQRRPVTVVQVADSLAMPAETVRRH… |
| A0A0S9CB79 | 22-168 | None |
| B4REP9 | 123-310 | None |
| A0A4R1YLZ4 | 10-173 | None |
| A0A7W9CLG0 | 36-187 | None |
| A0A227KAD0 | 4-125 | None |
| A0A1Y0E9I0 | 4-148 | None |
| A0A844BCB0 | 26-180 | None |
| A0A4R4DTB7 | 108-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.