DPCstruct | MC1467
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 148 ± 20 aa |
| Standard deviation of domain lengths | 20.15 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9Z8M0 | 2-131 | EATFISNSSSPNTTFHVLSDNSTVTSLIQSIDANCSHYLSSSSSSSPVPFDVSSANAPQPQQAIQYYRASSVVLTLDGYNNSATFSS… |
| A0A4S4L1K8 | 166-318 | NLVSAIVQPSWNTSNVTYRIVGDNTSVIAVFDALVVNCSVANSSSAISAFSPSPSTWPLPEQIVQYYRASTFALSLDGYNNSASLQS… |
| G4TE68 | 15-185 | None |
| G4TUX3 | 74-251 | None |
| G4TV47 | 15-163 | None |
| G4TYY8 | 149-304 | None |
| A0A0C9UFT3 | 2-133 | None |
| A0A166DI32 | 111-258 | None |
| A0A0H2R906 | 233-424 | None |
| A0A0D0AQ66 | 60-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.