DPCstruct | MC14669
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 238 ± 27 aa |
| Standard deviation of domain lengths | 26.81 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10070 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7S7T0 | 259-489 | SGGPEEAAADQSARFKARAKRAWGRFKLAAVSSFAFVEATGPVYASKLVSDALGLHGSAAPNDPAPRLDPALDLATRTRAAGTVLRA… |
| A0A090D0J7 | 317-567 | EEPILDEIGRISHHQKGRSLINIFRRFYQDLKYNFATPFALVETLGLWCGFWMAMRTLMPASSVKFKKAIQEMLKPTLATLPKIDIP… |
| A0A2T2X529 | 581-852 | None |
| A0A023DZY0 | 2-200 | None |
| A0A0J9EBB0 | 780-1048 | None |
| A0A522EZJ1 | 3-199 | None |
| A0A7R8B2M1 | 445-717 | None |
| A0A7Y4QD32 | 15-252 | None |
| A0A7H0GF29 | 225-452 | None |
| A0A2S5JI27 | 396-615 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.