DPCstruct | MC14664
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 215 ± 25 aa |
| Standard deviation of domain lengths | 24.78 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A561BS73 | 34-265 | RPGDGSEFITHLIAAVAANLGSSAAVITSRPGSWEAAGVRELLASTVGEDDEYLISHRTAPVEVVIDPEETLDDLGIYQAYEASADH… |
| A0A4R2DCR6 | 1-196 | MGSVEGLLRGRPTSWEADLIHQLITGAAAEEDLPARRTEPVRVPLDIDEEWDRFGLADLAQEAFDEINGRMLEVDDESPESGALADE… |
| A0A7J9W8Y8 | 35-281 | None |
| A0A7W3IPF9 | 33-221 | None |
| A0A6J7FZ80 | 1-249 | None |
| A0A4R2CCZ3 | 8-195 | None |
| A0A1J0TYP2 | 71-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.