DPCstruct | MC14661
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 86 ± 7 aa |
| Standard deviation of domain lengths | 7.17 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6D507 | 26-111 | SRKKGSGRPPIINTEVREQLLKELDDPQGFKSYEEIRTWLKAVEGVEASYKVVHDTVRYQMKAKLKVPRAVGIKHQPEAEEEFKKN |
| A0A496ANF6 | 2-76 | DRAYSPGRPPELTKEQQEMLLSELQKPQGLSSYQQITDYIEETFGVKMSYPAVHNLIRYRLNAKLKVPRKNHKKR |
| A0A3M1LDU7 | 5-105 | None |
| A0A7Y2CA84 | 22-115 | None |
| A0A2D0H9F9 | 2-88 | None |
| A0A0P4V7Q8 | 2-79 | None |
| U5DIE6 | 43-123 | None |
| A0A1Z4TVV9 | 118-204 | None |
| A0A1Z4TW20 | 14-100 | None |
| A0A5A5RV60 | 31-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.