DPCstruct | MC1466
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 55 ± 3 aa |
| Standard deviation of domain lengths | 2.63 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 79.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 62.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A165QBR3 | 1-59 | MWTGDRWWELQEKLPAGATIAPIILSSDKTKLSQFGGDKAAWPVYLTIGNIAKHIRRQP |
| A0A0C9Z809 | 1-53 | MWMGNWWWETQCHLPSGSTVSPVILASDKTELSPFKGNKNAWPVYLSIGNLSK |
| V2WQV5 | 1-53 | None |
| A0A5M3MIJ4 | 149-207 | None |
| A0A409X8F7 | 33-87 | None |
| F8PHK9 | 541-599 | None |
| A0A1B7MER1 | 1-53 | None |
| A0A0C9YUV1 | 282-334 | None |
| A0A0C9TNZ7 | 83-141 | None |
| A0A0C3E236 | 22-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.