DPCstruct | MC14659
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 271 ± 67 aa |
| Standard deviation of domain lengths | 66.58 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 82.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 17.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7T1E7 | 4-195 | MTSALAKHRPVKVPAIKQGKSDPRYNPEPPRDGFVVRVTSKVLGGYPQTEDPWKRIFQESIGRDNLWVRADETKALIGDQFPESLMS… |
| A0A496A1W9 | 13-264 | RLQVHAHWEPIADSTFRMHQMFPEHIELFDLSPTQPIKEYQTDAFNAFLPLSTVTVGDVWELDANSIVSFLHQFHPGATADLGYGEE… |
| A0A7C7Z9V5 | 2-167 | None |
| A0A7D9DIK5 | 26-423 | None |
| A0A7Z9H676 | 84-330 | None |
| A0A7W9W805 | 53-256 | None |
| A0A091E5A4 | 2-320 | None |
| A0A6S7GKT1 | 26-410 | None |
| A0A1Y0GZR7 | 93-309 | None |
| A0A3E0PWD6 | 58-338 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.