DPCstruct | MC14657
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 91 ± 7 aa |
| Standard deviation of domain lengths | 6.55 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 44.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5F9CU50 | 401-493 | KRMLPPEALVPYYTDAKNRGYLADPAKFPEARLELARKYGYILPDITKDELFKMLSTRKDPRQIFFGLAPGWVVNMADKKILKPTDE… |
| A0A2G9QKN2 | 23-115 | KRMLPPEDLVKYYTDAEKRGYLADPIKVDEARKQLALKYGYILPDITKDELYEMLCQRKDPRQMFFGLAPGWVINMTEKKILKPTDE… |
| A0A0R3QIG9 | 2-80 | None |
| A0A3P6THT2 | 51-137 | None |
| A0A7M3RFV2 | 59-144 | None |
| A0A7R8XIG3 | 666-752 | None |
| A0A226F5N1 | 193-292 | None |
| A0A0B1SXX7 | 28-114 | None |
| A0A226NZ23 | 119-204 | None |
| A0A6J0XDA8 | 2-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.