DPCstruct | MC14654
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 80 ± 12 aa |
| Standard deviation of domain lengths | 11.54 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 71.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13297 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9P890 | 106-201 | SVSGQTEPSEAIPETEKPTFIPDPPKESPGMDSASFDLMSFSSAVQLEALGLDKLKMELIALGLKCGGTLQERAARLFSVRGLSRDH… |
| A0A161MZF0 | 4-65 | HILDLSAFSSPEELASLGLDRLKSALMALGLKCGGTLEERAQRLFSTKGKKSLDPNLLAKSK |
| A0A0L7QKR5 | 488-559 | None |
| A0A3Q7ELQ1 | 166-246 | None |
| A0A816J8E7 | 795-852 | None |
| A0A498LYG3 | 2-80 | None |
| S4RR83 | 320-401 | None |
| A0A6D2JX25 | 193-252 | None |
| A0A7M5VEK4 | 378-454 | None |
| W4GHS0 | 541-626 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.