DPCstruct | MC14652
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Standard deviation of domain lengths | 8.53 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 53.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U3K191 | 4-86 | GKSPVIIDNTNIHAWEMKPYVMMAHENRYEVTFQEPDTPWKFNVQELTRRNIHRVPREKIQRMKEQYEHNVTFHSVLRSEKPS |
| A0A2G9P7T8 | 1-86 | MTRGKTPIIIDNTNILAWHMKPYAVMALENAYQVIFLEPDTHWKFNVKELTRRNSHGVPREKIQRMKDVYEHNVTFRSVLHAEKQS |
| F1MV44 | 456-569 | None |
| H0XDZ0 | 11-112 | None |
| A0A6I9KMD2 | 160-244 | None |
| A0A6P8RHK9 | 672-774 | None |
| A0A091DSB4 | 526-622 | None |
| A0A822DIG0 | 51-135 | None |
| A0A553QCD4 | 221-304 | None |
| A0A2J8UTI0 | 455-556 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.