DPCstruct | MC14650
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 69 ± 11 aa |
| Standard deviation of domain lengths | 10.82 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.78 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 52.21 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | CL0123- PF07382 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A317D031 | 2-75 | ASTGTATSTEKGRRIIGAERQTLAKDLVKRYTSGESIRALAASTGRSYGFIHRVLTESGVQLRQRGGARRRKKA |
| A0A7W3P5T0 | 1-69 | MAKALAKGSRITGAQRATLATQFAKRYAAGESIRKIADDAGRSYGFVHGVLTEAGIGLRGRGGATRGAK |
| A0A7Z0DBE5 | 45-114 | None |
| A0A1V2P5H8 | 2-53 | None |
| A0A160NW95 | 2-61 | None |
| A0A225TIY5 | 2-53 | None |
| A0A6I1ZH63 | 3-66 | None |
| A0A221W7A0 | 7-70 | None |
| A0A7W5P845 | 8-78 | None |
| A0A2T2ZPB1 | 12-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.