DPCstruct | MC1465
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 144 ± 9 aa |
| Standard deviation of domain lengths | 8.88 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 70.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9Z741 | 1-137 | MLTTMMMPTRSSRSSSLHDQHHDNPILHRHAPKAFPTSSPASSSTTPMVYIHIQNLSGVVSSHHHVMQPSPEDRAQARWLGEAGARY… |
| A0A0C3DKC1 | 454-579 | LSVTPPSPSFTLSSSVASASSLASSSLSSTSRADASPLIYTHVHNLRGILSSNYCQTSTSRVEGQAKSLGALAAQYLALHGYGTADV… |
| A0A0C3PQA0 | 288-441 | None |
| A0A0C2ZTF0 | 157-302 | None |
| A0A0C3IZ64 | 84-230 | None |
| A0A165ZCF5 | 35-190 | None |
| A0A0C3NXZ2 | 176-323 | None |
| A0A0C3NHG5 | 114-250 | None |
| A0A371CNZ3 | 193-340 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.