DPCstruct | MC14649
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 137 ± 13 aa |
| Standard deviation of domain lengths | 12.54 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G1X8V5 | 2-143 | LAGRGRWIIQRYETDPAQIDEIYLVEAGPGEKICVPPSFGHITINAETEPLVIANVIADKVGYDYEPYKILRGAAARLLASEAPSMI… |
| A0A7J4AAE5 | 110-243 | VYQIIKGEALFILQKVEDDEVKEAIIIKAKEKDVVMIPPNYGHNMINIGNDILVTMNLVSDRFLSLYEPYKYKKGSCFYFLKNNKLI… |
| A0A7J9PXR6 | 1-141 | None |
| A0A2I0QL38 | 9-130 | None |
| A0A0G0WBD4 | 439-572 | None |
| A0A7V5Z0W8 | 164-306 | None |
| A0A7C1BTQ9 | 2-151 | None |
| A0A1W9P5L0 | 753-895 | None |
| A0A7C7RP37 | 98-206 | None |
| A0A355UXB4 | 1-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.