DPCstruct | MC14643
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 63 ± 2 aa |
| Standard deviation of domain lengths | 2.43 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 92.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 41.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F9XSZ9 | 1-60 | MKKVIALAANYGYLDKAETTLKSIFKHTPKAEVYLANMDIPQEWFAAVNEKLAPVGSKLH |
| M5K3B8 | 1-68 | MKEEKKEKKAIVLGADNAYMDKVETTIKSLCVHHYNLKFYVFNDDLPREWFQLMEKRLETLNSEIVNV |
| B3XPR8 | 2-61 | None |
| A0A0F3H4R1 | 401-462 | None |
| A0A448KKH1 | 6-67 | None |
| A0A256VEI5 | 2-64 | None |
| A0A496LVN3 | 1-62 | None |
| A4NVK7 | 1-63 | None |
| A0A0H2ZMZ5 | 1-65 | None |
| A0A0T8U625 | 10-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.