DPCstruct | MC1464
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 211 ± 18 aa |
| Standard deviation of domain lengths | 17.82 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 70.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3DB06 | 4-196 | SIKIKITPSMLVDAAYLWLEKYAKNEVTLFLVKQKIELELATVGVVYQGDLWEDILERMVVSPMGWQEVQAAWQAAKASLPPLVKDV… |
| A0A0C9Z1V7 | 1-206 | MAPPVHLPCAALNDAAFALFEQYVQGKISDMVALSKIDVELAITKICFEPEEWLDLIKIILMNPTEGLDSIRAAWQLMWVKVVPLLE… |
| A0A0C3AR64 | 2-216 | None |
| A0A0C2ZX66 | 1-230 | None |
| A0A0C9YXV7 | 1-207 | None |
| A0A0C9XRT2 | 1-207 | None |
| A0A0C9XHX7 | 1-207 | None |
| A0A0C3KEE7 | 1-235 | None |
| A0A0C3DAL2 | 57-296 | None |
| A0A0C3PEI7 | 1-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.