DPCstruct | MC14637
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 91 ± 8 aa |
| Standard deviation of domain lengths | 7.78 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L8T2G7 | 1-97 | MGKIIEGLWDCTFCGNKRIRAGQKTCPDCGHPQDENTKFYMPDEIKYVSEEEAEKISRNPDWQCSFCGSLNSDDLNVCKNCGATKED… |
| I4B614 | 8-98 | EYVYEYWDCAACGRRGVRGDARYCPSCGKARDKNVRFYRQGDKEETITEKAEQDRLSAGPDWICAFCSTTNNFHDQFCGSCGSGSDT… |
| K1RWI5 | 3-91 | None |
| A0A136NXS1 | 120-200 | None |
| A0A1F7X412 | 1-89 | None |
| A0A1F8PZ12 | 2-93 | None |
| A0A1T5BD77 | 2-98 | None |
| A0A7S1VQ98 | 568-650 | None |
| A0A518DWA5 | 6-89 | None |
| Q1CZE4 | 1-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.