DPCstruct | MC14632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 160 ± 21 aa |
| Standard deviation of domain lengths | 20.50 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.32 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0229- CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3JKA1 | 16-134 | FDTEQPLPVEGEEPRDRNACRVMEQKETVDGLKDEFCGRQVPPRYAGLCEIHYKEYLVSLINRHHIDPLIILSLNEIKMVLGRVDKQ… |
| A0A7J7FCH3 | 1-121 | MFNTEPPAGARAVPGGGCRVMEQKEVPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLINAHSLDPATLYDVEELETAAERYLHVRP… |
| A0A1I8H8R9 | 1009-1165 | None |
| A0A443SU71 | 850-1020 | None |
| A0A484CRV1 | 157-344 | None |
| A0A444SK79 | 689-852 | None |
| A0A7R9KV02 | 347-519 | None |
| V9KDG0 | 536-708 | None |
| A0A267FTP2 | 68-229 | None |
| A0A0K8T469 | 1078-1244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.