DPCstruct | MC14630
Metacluster Properties and Pfam Annotations
| Number of structural domains | 125 |
|---|---|
| Mean domain length (aa) | 265 ± 63 aa |
| Standard deviation of domain lengths | 62.75 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 89.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 23.42 |
| Pfam Score | 98.04 |
| Assigned Pfam label(s) | PF00285- CL0042- CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4CIM7 | 2-208 | RPDGFSARAMDVSFILYAEHEMNASAFTAVVIASTLSDYYSAIVGAIGALRGPLHGYANVAAMRQFEEIGSPDNVEKWYKENILTGK… |
| A0A6A3D5N4 | 41-337 | AHPMGVLVSAMSALSVFHPDANPALRAPTIAAAAYLRMAGRPPVLPSNNLSYSENFLYMLDSMGNRSYKPNPRLAIVLDILFVLHAE… |
| A0A258JD30 | 66-405 | None |
| A0A654GRC5 | 76-467 | None |
| A0A7X9CDG0 | 5-237 | None |
| A0A1A9VK80 | 131-482 | None |
| A0A6U1PJ67 | 221-443 | None |
| A0A1I8ING8 | 117-336 | None |
| A0A2V7YEY6 | 265-585 | None |
| A0A1F8NZ23 | 2-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.