DPCstruct | MC1463
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 117 ± 9 aa |
| Standard deviation of domain lengths | 9.39 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 30.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9TQV0 | 4-100 | SRSHHSPSPEQPPDFKTEFHPRSNRPPLFHQQEEFGMQNVDQMAADNHPWRPFAEQGDYLFAEIALQAGLNASQVNGLLRLISHISQ… |
| A0A0C9Z1J7 | 1-112 | MTAIAASCSTNHPHDFKTEFHPCSKCSTLYQSFEDFGQQNPEHIMAPDSEPWHPFASEGNYIFAMITVEAGLSSTQVDTLLMLVHCI… |
| A0A0C9YJR7 | 8-122 | None |
| B0DHI9 | 148-266 | None |
| A0A1C7MBK7 | 96-217 | None |
| A0A4S4L312 | 151-281 | None |
| A0A0D0CRC7 | 58-188 | None |
| A0A0D0CJC7 | 54-181 | None |
| A0A5B1QVD6 | 159-284 | None |
| A0A0C9YXU2 | 140-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.