DPCstruct | MC14626
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 207 ± 15 aa |
| Standard deviation of domain lengths | 14.57 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 50.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9DLK7 | 56-256 | SPVMEVDPEYPGTAVERLRNIQARVKSLTPEDLSKDWEEVRRKILWAGGLKDLPRNVPGQGYTGHSFNDDNHCDLTPMLGEVAHNLH… |
| A0A0G4ETU8 | 1-179 | MAKAESLAKEVSLNGDFSEVRRQLVSACGLKNSYQTGHCFGDYNHVDCCTMQMEYSTELNNNRVAGMHATNPLAHVINPNSIQDSSF… |
| A0A454XXK1 | 1-206 | None |
| A0A812USD9 | 9-221 | None |
| B7FXX0 | 52-268 | None |
| K0RPR6 | 1-240 | None |
| A0A812XU16 | 56-256 | None |
| A0A0M0JV29 | 419-623 | None |
| A0A7S0S8Y3 | 143-343 | None |
| K8EF92 | 82-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.