DPCstruct | MC14625
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 111 ± 12 aa |
| Standard deviation of domain lengths | 11.95 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 52.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08561 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4ETJ2 | 1-116 | MSLAPKKKKAEAAADKGAAAPSEPTSGQLFNIFIEKSDPKLLPDHCYPDWLWGMDKPSKTYGELSLMFVYGQGIENATFTEYRQFLR… |
| A0A2T7IQW9 | 43-138 | VDYSPTDEDDEHIFNIYASIKEDHELLPDEAYPDWLWQLDKPDKSYGELIQMFVYGKDIENSKMSDYNRFRRLHNRYMIKLNNIRLQ… |
| A0A1X1BMU7 | 439-553 | None |
| A0A2A9MBJ9 | 109-231 | None |
| A0A0F7UBV8 | 312-435 | None |
| A0A2H6KG22 | 13-125 | None |
| C5LQS4 | 5-90 | None |
| A0A7S3WIQ0 | 1-100 | None |
| A0A7S1AS63 | 67-178 | None |
| S8F6A8 | 395-515 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.