DPCstruct | MC14622
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 192 ± 38 aa |
| Standard deviation of domain lengths | 37.93 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4EKN9 | 2-207 | SSGLKHAVKSRVHLERGAPRHRQRYGLLEKHKDYKLRARNYHAKEKQLSILQEKARSRNPDEFYFKMVNASSKKPSGPGQSKGQQRL… |
| A0A060TCM8 | 10-217 | KQHRERSQPLERRKWGLLEKKKDYQLRSKDFHRKEAALKLLRKKASERNPDEYHHGMNSQKTDKNGILITDRGNEVLSNSGAKLLKT… |
| A0A7C8QZ26 | 497-720 | None |
| A0A0F7SWA9 | 3-223 | None |
| B0ECB3 | 9-173 | None |
| A0A3B0MPU7 | 1-189 | None |
| A0A7J6L103 | 6-233 | None |
| A0A1I8FUL3 | 73-288 | None |
| A0A183X212 | 1-187 | None |
| A0A834Z2D5 | 1-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.