DPCstruct | MC1462
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 110 ± 9 aa |
| Standard deviation of domain lengths | 9.16 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9Z0Y3 | 8-105 | AAENNELLLLQALMIELGIRSPRDLPSTLTSSRKVLKSEVHINIKDYVATRGKGQAALRQIMHPSKKSLRREIQKPGRKASLKWVKQ… |
| A0A137Q5R9 | 322-427 | TSYISNTSAHHDQICHLTLLQSLIIELQLIKDISQLPRSIKTAKKFIKPRVFLNVKEYLKKRQEGPEVVKSLMYPSRSALVRHMRQK… |
| A0A5M3N255 | 157-257 | None |
| A0A5M3M8R3 | 11-117 | None |
| A0A0B7F482 | 412-516 | None |
| A0A0D7BEM5 | 118-218 | None |
| A0A4Y9YLD3 | 117-228 | None |
| W4KI04 | 11-130 | None |
| A0A5C3NKZ2 | 3-106 | None |
| A0A1Q3EMQ0 | 772-879 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.