DPCstruct | MC14615
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 215 ± 40 aa |
| Standard deviation of domain lengths | 39.68 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 22.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7FII9 | 614-821 | REEAVAGPSNEEGIDGGMAVDLEEKILNQVKMLSEMFENADPDYLQERCVAISGNDTKFQEVVNGLLQSTDYPKIEEYHKRQKRLEI… |
| A0A7J7AGV8 | 306-503 | RTKCESPPTVLDPSEQLEIMKGILVDADPDYLQMQCDMLIDKPDELKAFIDRAIVERDYPTYKDFLRRQQLSAQQKQYSSGFTVEHF… |
| A0A7E4S5D2 | 22-203 | None |
| A0A815S9L2 | 246-434 | None |
| A0A813S0V1 | 2-302 | None |
| A0A7R9B8V9 | 649-837 | None |
| A0A7R8Z9X3 | 438-635 | None |
| A0A821YZ14 | 125-408 | None |
| A0A7R9F2S3 | 654-854 | None |
| A0A6L5CIS5 | 375-571 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.