DPCstruct | MC14613
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 464 ± 66 aa |
| Standard deviation of domain lengths | 65.67 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 16.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A167ZS20 | 94-541 | IKLHQQNLADKASQTPQPILIQAAVILEHVLVGSPHNYEALLLLSRIYLLLGAGSLALQTFAKLNVKQMQYESVAHNLFTRLATIHP… |
| A0A3M7PV33 | 3-478 | VHIGYDLWKKFKHESLLHLVAKLKMGLKNSPTNFQIKLLLLNLYSHLGAYDSIKIMYDSMDIKNIQYYSTSNLLIFNNIRLGSFESS… |
| A0A1Y2H8Y8 | 213-671 | None |
| A0A015JHL4 | 3-413 | None |
| A0A2D4BK29 | 478-896 | None |
| A0A6F9CTE5 | 333-704 | None |
| A0A5N5H0T0 | 159-678 | None |
| A0A5B0R8K2 | 465-921 | None |
| A0A067FI15 | 28-639 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.