DPCstruct | MC14612
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 68 ± 4 aa |
| Standard deviation of domain lengths | 3.69 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 43.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z9E185 | 5-73 | FEIRQKVRVIAIPPYLKTAEPMPILRPSNLINIGEVGIVIDRRPGGYWGVLFQKGAFLIDSQYIESLKS |
| A0A2D6Y753 | 2-69 | SFSIGDKVRLKDVVSYLKTADPMPMLRPPDLISPGEQGEVVALHPADTLAVRFRRGSFLLSTSVLEMH |
| A0A2N9HEJ5 | 107-175 | None |
| A0A6P0WRA3 | 5-71 | None |
| A0A6P0TJ40 | 44-112 | None |
| A0A6A2YU19 | 185-254 | None |
| A0A1Z8N917 | 2-64 | None |
| A0A4P7ZR60 | 11-79 | None |
| A0A0U9HII3 | 123-193 | None |
| A0A6N2L7T4 | 157-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.