DPCstruct | MC14611
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 139 ± 18 aa |
| Standard deviation of domain lengths | 18.43 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.89 |
| Pfam Score | 97.83 |
| Assigned Pfam label(s) | PF16107- PF17225 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B6GB43 | 285-425 | YGDVAPYANTDLSDAKAVEALVGVLPMGEYASGIDVTKGVDVLSLAYRELPEALDGDSVDAALAYDVTALFCAMPFVNEIQITVTER… |
| A0A370GR72 | 82-219 | SETGTAKHFAYAGETMNLYDLSKLQTPYVGNNSKVIQIAHSLPGGGLVKEISLQTKTASYGVTITYASKNSKQFDAFTQSGLKDKML… |
| A0A1H3SMR9 | 20-168 | None |
| A0A354Z159 | 184-308 | None |
| A0A6P1TPT7 | 30-192 | None |
| A0A117DP42 | 7-135 | None |
| A0A437S552 | 17-155 | None |
| A0A1H3I531 | 39-181 | None |
| A0A7X3SL43 | 222-353 | None |
| A0A847XCW5 | 128-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.