DPCstruct | MC14608
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 314 ± 50 aa |
| Standard deviation of domain lengths | 49.80 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16595 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X2MG10 | 27-277 | LIPIKKDKPTNIYGGYKGKVSSYMMLVKIQKKKEIIYKFVGVPRLWTDELDRLNDTDEKKALLKKIAKASLSKAEQNFEVILDKVYY… |
| A0A133ZZY1 | 63-355 | ILVTRRTSEQKGGLFDATVYKAKVAAKAKDGVYYPLKTSNSVVKDVAKYGGFTKIKIAYYSIFEYVLVNKKGEEKITRIIPIPIYIS… |
| A0A1X2Z837 | 82-392 | None |
| A0A3A9AFZ7 | 363-710 | None |
| R7KAN2 | 773-1058 | None |
| A0A0X8KN88 | 908-1263 | None |
| A0A1H7I2G4 | 485-828 | None |
| A0A645BQY5 | 4-229 | None |
| A0A4V6L3I5 | 226-623 | None |
| A0A2S3U2K5 | 608-963 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.