DPCstruct | MC14606
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 109 ± 9 aa |
| Standard deviation of domain lengths | 9.28 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q125Y8 | 10-116 | WLDALRTEVERTSQARVAERLRISEATVSQVLSGNYKANTQRIERRVLGELLGRQVECRVLYDISLRVCQDVQERPRGAGSNPMHQQ… |
| M3AAF3 | 16-122 | DWLAQLRAEAAATSIAAAARRIGMARASVSLVLSGGYPAGLDRVEARVRAKLMDQVRCPAFGEDIALAKCRAQAAKPFSAASSRAAR… |
| A0A2A4ZAU8 | 24-135 | None |
| A0A1G8G6N1 | 6-107 | None |
| A0A7L5XUP8 | 1-96 | None |
| A0A1S9AFQ1 | 5-107 | None |
| A0A3A4N5R8 | 1-99 | None |
| A0A1Q6UEP1 | 13-115 | None |
| A0A1X3CP88 | 4-99 | None |
| A0A1D9CY06 | 25-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.