DPCstruct | MC14603
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 139 ± 23 aa |
| Standard deviation of domain lengths | 23.28 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G8MCL5 | 1-85 | MCSKLLGDTYYAALEQQRSDGAREVFALVCLTYYNPRDPEGFIFGYKDMTEAMGPCASDCPEDILDLLTPTDRPYAIAWRARCRE |
| A0A2T4MWN1 | 1-146 | MGWTFINKPDNIKQFFTEMFEDDGDKIKYKVLDAKIVSLRTLYMAIEKTYPESKDRDVFGLVVLLDMTSARKEYHNFGYKIIDENAC… |
| A0A7W5X5I3 | 1-157 | None |
| A0A8A9F4X6 | 1-127 | None |
| A0A7W7EAE1 | 1-164 | None |
| B6WRT4 | 1-116 | None |
| A0A509J6Z7 | 19-155 | None |
| A0A246BX54 | 4-149 | None |
| A0A2W4YER3 | 1-134 | None |
| A0A7T8M662 | 1-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.