DPCstruct | MC14601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 140 ± 11 aa |
| Standard deviation of domain lengths | 11.34 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 68.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.25 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0283- CL0173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397XT83 | 158-315 | MIEKIVRDVSDKLNATMWAKTGYSTGMALLVVINLLLEIASAGADQLSSTRKPYFSKVSLLMSVLSLILSTLDFTYKIRAHKARFRF… |
| A0A067DQI3 | 129-269 | LTKASITKVDLECIFPITNFVLELPSAVFDQLSSVRKPQYALLSMLMSFAALLICIVELICTCRKQRVRWKWIRTLPWLYHPRNRPF… |
| D7L5B3 | 2-158 | None |
| A0A5N5FS37 | 530-664 | None |
| A0A2C9VYQ9 | 418-548 | None |
| A0A3N7G2G1 | 259-379 | None |
| A0A835J2W1 | 217-358 | None |
| A0A7C9DGA2 | 174-315 | None |
| A0A7C9DBY4 | 205-347 | None |
| A0A5H2XHG1 | 426-550 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.