DPCstruct | MC1460
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 174 ± 26 aa |
| Standard deviation of domain lengths | 25.95 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 21.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P9IEI7 | 2-137 | AVPLLLGGSPAYAVAKLPDGLIHIDIHEAKDPDKLEADLRNMGANVVVDYIPMGKKCSPQPRSSHFLSSEEAPLHVFPTPEEAGPGF… |
| A0A365H3T0 | 21-227 | AIAAARARLAARARPETARTRRRPVLPLGRRHALAAVGVAGTATAAVLAPAVLGGDHADRAYAVERLPDGRIKVTLHEFADSAGLQR… |
| A0A1E5PKZ1 | 5-192 | None |
| A0A5J6JII0 | 28-237 | None |
| A0A7C9J1Q1 | 28-183 | None |
| A0A7X0M9N8 | 1-210 | None |
| A0A1H1RN11 | 12-179 | None |
| A0A372JFR0 | 88-241 | None |
| A0A5S4G3I7 | 2-170 | None |
| A0A3N4SUY0 | 9-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.