DPCstruct | MC146
Metacluster Properties and Pfam Annotations
| Number of structural domains | 102 |
|---|---|
| Mean domain length (aa) | 124 ± 27 aa |
| Standard deviation of domain lengths | 27.10 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 84.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.68 |
| Pfam Score | 88.76 |
| Assigned Pfam label(s) | CL0758- PF04874- CL0015- PF01778 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9U7H9 | 4-106 | VSDDLIWLLVKNSNRFLVKRNGNNNNSVTFSSEPNNLYNLNTFKYSGLANKKSVAIAPAEGLSVVLTTTKTKKRNQPAKLRHNSLLK… |
| A0A6P9FKL5 | 2-72 | SAHLRWMVVRNCSSFPIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVVMKRRSGQRK |
| A0A6V7WWR2 | 95-245 | None |
| A0A212C6A1 | 2-99 | None |
| A0A452T226 | 2-88 | None |
| J5TMW7 | 99-213 | None |
| A0A6D2I5Y7 | 3-98 | None |
| A0A7S1Y0J8 | 46-186 | None |
| R9P3R1 | 100-227 | None |
| A0A7S3JMK9 | 9-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.