DPCstruct | MC14599
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 86 ± 8 aa |
| Standard deviation of domain lengths | 8.49 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 53.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7LX18 | 1-93 | MDLIESIHDIPVQNPSVEDFSASDLNWIKFGTPEHHDDVALIPYARAEEFIIGECSNVECPTRFHIERGRKRSLGSLMEFKSDEYLE… |
| A0A067D2C6 | 1-90 | MDIVESLFDIQVQDPPEEDFSSIDLTWTKFGTAEHHDEVALIPYARVDSFIIGECSNVECPTRFHIERGRKRSRGSLKEYKDDEYLE… |
| A0A1S3Y6X4 | 7-98 | None |
| A0A830CF18 | 26-91 | None |
| A0A565BRS8 | 7-81 | None |
| A0A445BZB9 | 186-275 | None |
| A0A5A7T5N1 | 7-87 | None |
| A0A6A2X7D4 | 45-135 | None |
| A0A540LCU7 | 154-252 | None |
| A0A660KX92 | 167-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.