DPCstruct | MC14594
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 162 ± 21 aa |
| Standard deviation of domain lengths | 20.72 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812MNF1 | 1-122 | MKSLANYDETNPKAVIDSPRSLQACRQEGVLPQELIFKPVEAFQERNLSPRLVKLRYDFFEAKRRDLLAAARRARDSILADEHRDKE… |
| A0A0L8HE86 | 4-171 | DSPKLTLYNFDDPQYDNCSYVLTSPRSLEACSRMGVKPVDLLYTPPTDQDHQICHLLYPDTLCSRLHNEQEDLRQLKLKLCLEERNR… |
| A0A673J557 | 2-141 | None |
| A0A819Z6D9 | 46-193 | None |
| A0A812CQ70 | 2-161 | None |
| A9V3E2 | 15-156 | None |
| A0A7J7IRR9 | 13-158 | None |
| A0A7S3G997 | 25-162 | None |
| T1F775 | 9-180 | None |
| A0A7J7J9C6 | 1-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.