DPCstruct | MC14593
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 104 ± 15 aa |
| Standard deviation of domain lengths | 14.70 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G9A7X8 | 7-105 | LAVGTKVQFAESKRWWRVRAVSEDNNFVILTSPFNLKKTVQYTIIDNRRGVRGPDDRIFSNGYESDEDINARLSELVAGSISVSKKT… |
| A0A6H2A5X3 | 1-91 | MVGNKIKMNGEVQRYTIQAHDDRYFILTKPMNAMKSYIYCIVDLERKVRSTDNLVFGSFKEYNTKEGAEENLKMLQNGEMELSRRKE… |
| A0A1X2Z2S3 | 188-298 | None |
| A0A1A3D9A8 | 78-211 | None |
| A0A6N7ZN57 | 3-119 | None |
| A0A1F2Q3F5 | 43-148 | None |
| A0A4Y8QYQ9 | 8-121 | None |
| A0A1E3M1K6 | 1-91 | None |
| H0R592 | 46-169 | None |
| A0A1I4N2N5 | 133-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.