DPCstruct | MC14592
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 81 ± 8 aa |
| Standard deviation of domain lengths | 8.18 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R2MTU5 | 33-112 | HKQTNKERKVFHITNNQLRFNIAECNDIDDWYLDGYRTGKSYSQYKEKMFSQRRNYCEESTGKKINKKFQKSWENGYKKG |
| B0BUC0 | 1-85 | MYSPPVKQDKKVAIKQSITHERINTTECKDADDWYLDGYRVGRSFSAQKEAMYQKRVNYCKGMLSNANQFQQNWEKGFKVGVKKA |
| A0A1V3KXP5 | 1-91 | None |
| A0A1V3K3N5 | 6-96 | None |
| A0A377JG59 | 2-68 | None |
| A0A3S4Y0F6 | 67-136 | None |
| A0A369YEV0 | 39-123 | None |
| F9Q995 | 19-92 | None |
| A0A3N4VS77 | 50-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.