DPCstruct | MC14591
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 499 ± 44 aa |
| Standard deviation of domain lengths | 44.21 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0475 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B5I525 | 7-503 | PDLPAHVRAQLTNSARDLCASVGYRSAGTVEFVYDAAREEVYFLEVNTRLQVEHPVTEEIYGVDLVAWMLRLARGERDVVSEPGPPR… |
| A0A1Q7Z2I0 | 2-468 | PELQKLCDGAALLSIANKDALDLAAAFADDPPEGLLDAVPGARTLLLLYDPELLDIERLDLSRRGERPPPRVVRLQACYDGADLDDV… |
| E1QDN5 | 5-510 | None |
| A0A133ZM80 | 2-512 | None |
| A0A5B8M4B0 | 3-547 | None |
| A0A7W0TZP4 | 1-439 | None |
| A0A4Q8AFG0 | 4-536 | None |
| A0A077ZC64 | 243-699 | None |
| A0A0A2VUI6 | 198-660 | None |
| A0A7V2I755 | 158-689 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.