DPCstruct | MC1459
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 76 ± 8 aa |
| Standard deviation of domain lengths | 7.69 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A365GY84 | 1-72 | MLSRIEIAAVTEQIAHRASRLLAGASLHGHKYAIDALVAATALLAPGPAVILSSDPEDLTVLTQGRVRIVKV |
| M3B2U7 | 3-63 | DEEAKTASALLMSAGLHGHKYAIDAAVAETALRQRRPVVMLTSGVDDMTKLCGDRIRLIAV |
| A0A4U0SM57 | 26-112 | None |
| A0A345STX5 | 1-82 | None |
| A0A7W7UU78 | 30-109 | None |
| A0A100JUW4 | 54-121 | None |
| A0A1V2IJL0 | 10-89 | None |
| A0A6I6F8H7 | 1-80 | None |
| A0A4Z1D4J5 | 1-65 | None |
| A0A1G6RLE2 | 36-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.