DPCstruct | MC14589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 57 ± 7 aa |
| Standard deviation of domain lengths | 6.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 72.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G6T0X1 | 6-64 | ATAQDCRAMLRLVRMAIEETCPAGVLPGDEAVTGVYGPELIHEAEALAKAIIATVEKLT |
| A0A3S3HXA4 | 7-63 | ICNAWAALKLVRMAIEQTCPAGVLPSEEAVLLLYGPEPVHEGEALAKAIIETVGRLN |
| X5YJ00 | 4-64 | None |
| A0A528A8V7 | 2-48 | None |
| A0A2P9AJJ7 | 35-99 | None |
| V7F8K2 | 29-89 | None |
| A0A3S3IC18 | 25-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.