DPCstruct | MC14588
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 182 ± 31 aa |
| Standard deviation of domain lengths | 30.69 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 37.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0RIA5 | 40-226 | QAHGDHAHEAAPPVDANADWATRHMAEEHHIANFDAGSFFNLHDYDSSNFWSMDDLLETYGLRDESTNHISEDEKRRSIQRVIEMYD… |
| A0A5B0RNZ4 | 21-206 | SIDAHSSHNDSPADPSADFLTVHMDKEHHIQGFDLESAFHLHDLNSDNILEASEILKLYGVDHETAIDQSLSVDHHNSIASRILSEV… |
| A0A316ZRU0 | 23-228 | None |
| A0A6B0RSQ9 | 190-469 | None |
| A0A177TRG2 | 48-244 | None |
| A0A5N6KS04 | 25-234 | None |
| A0A4U0WRH7 | 129-305 | None |
| A0A0J0XY81 | 28-224 | None |
| A0A6G1HLD6 | 11-199 | None |
| A0A066V708 | 400-560 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.