DPCstruct | MC14586
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 153 ± 19 aa |
| Standard deviation of domain lengths | 18.58 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12842 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A078FXM2 | 19-157 | VRVVSLAMDRAIKEIVSGIVRRSVCIACQTTKELVLKDYALEPDEARIYSAAHLMVASLAGSFAHVTCKEPLRTSISRYLRHFLQDL… |
| A0A5B0RD50 | 1-137 | MTFSTEVVLNNNILWKRVVFTSIERAIRDIIGPVVERSVTIANISTREMILKDFAMEGKEDQMRTSAHMMVKNLAGSLALVTTKEPL… |
| A0A3P6SR21 | 2-128 | None |
| A0A287Q1K5 | 4-166 | None |
| A0A6V7PPE6 | 567-738 | None |
| A0A2T6ZIR6 | 310-500 | None |
| U6LCD5 | 232-345 | None |
| J4C7S6 | 656-796 | None |
| A0A183R3J7 | 46-180 | None |
| A0A1D6PMF5 | 2-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.