DPCstruct | MC14585
Metacluster Properties and Pfam Annotations
| Number of structural domains | 80 |
|---|---|
| Mean domain length (aa) | 109 ± 16 aa |
| Standard deviation of domain lengths | 16.06 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6NIT3 | 263-367 | SGNNFYDQFDFWTSGDPTHGHVQFKDRATAQKTGLISVQGDKVYMGVDHTNKAPKGRPAIRLQSKQSFTEGLLIIDLDHMPGSVCGS… |
| A0A5B0R9X4 | 104-227 | DLPIQLGYGREPNSQGKKYNLTLSSSGNKFFDDWDFFSDSDPTHGQVAYQPVNEAWKQGLVSVGPSSHDKNLITAKMKVDNTNWLAQ… |
| A0A3N4JBL0 | 6-129 | None |
| A0A842Z8U6 | 1-109 | None |
| A0A284QPY5 | 16-113 | None |
| A0A1L9WHY3 | 13-115 | None |
| A0A4U0W1W5 | 900-1003 | None |
| A0A4T0GC78 | 4-78 | None |
| A0A1B7YK04 | 1-98 | None |
| A0A0B7NN62 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.