DPCstruct | MC14583
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 72 ± 10 aa |
| Standard deviation of domain lengths | 10.16 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 54.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8MH93 | 49-114 | KRVGTHNGSFHCDEALGCFMIRLTDKFSNSEIIRTRDPKVLEGLDAVLDVGGVYDPNHDRYDHHQK |
| A0A060ZAD3 | 37-92 | IIGTHNGTFHCDEVLACFFLHQLPEYKDAEIVRTRDPAELAKCDIVVDVGGEFDPK |
| A0A6A4JY86 | 63-150 | None |
| A0A7R8XAJ6 | 137-225 | None |
| K8F387 | 87-154 | None |
| A0A4V4MDN2 | 365-455 | None |
| A0A1W0X7A7 | 457-524 | None |
| S4R8L1 | 41-108 | None |
| A0A6I9Q0Z8 | 63-130 | None |
| A0A453PAM8 | 51-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.