DPCstruct | MC14581
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 133 ± 8 aa |
| Standard deviation of domain lengths | 8.25 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060Z8C9 | 1-128 | MEAMGGIWNQERFDDYKLMLNRKQQCLIAWELIELVGMGHFSKGMNRQTLSMGISEVFQELILDVLRQGYMMKKGHKRKNWTERWFV… |
| A0A6A4TD93 | 134-269 | IIEEIEYFLRKLLETMGSEWSEDKFADYKLQLNTKNCLTAWELIELVGMGYFSKGMNQQTLSLGINEVFQELILDVLKQGYMMKRGH… |
| A0A674DNN4 | 139-274 | None |
| A0A7R9ACV0 | 733-858 | None |
| A0A401Q2V4 | 1-119 | None |
| A0A7R8WIX6 | 369-517 | None |
| A0A060Z3W7 | 2-135 | None |
| A0A4Z2IIZ2 | 57-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.