DPCstruct | MC14580
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 135 ± 17 aa |
| Standard deviation of domain lengths | 16.82 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 40.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8VZ65 | 1-136 | MLAIFRQMTAHHFEKYISHFSTTMDLLDFLMEILLVFKDLVSRPVFSRDWCQMIMLQNSVILKSLRFFSHTIRDYFFQPFEIQAWNN… |
| A0A060Z7K8 | 1-130 | MSDKHYQQLLQAFTSKDDLRDFLLQIFTVFRILIRPEMFLKDWTVMRLVTNNVIITTVLYLSDALRKNFLNDKFDYKVWDSYFYLSV… |
| A0A183H9Y4 | 217-353 | None |
| A0A2G9R6Y0 | 1-113 | None |
| A0A815KG31 | 290-459 | None |
| G3N403 | 506-635 | None |
| S9WYG2 | 174-292 | None |
| A0A821RRP8 | 859-994 | None |
| A0A5E4PVU9 | 631-776 | None |
| A0A7R8H2G2 | 110-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.