DPCstruct | MC1458
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 127 ± 9 aa |
| Standard deviation of domain lengths | 9.43 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A3ZKL5 | 10-128 | SPDTGNPWDSQETELNAELLTQLAQGTAPDSNPLETALSLTRFVREEFEAFGTEPAGLRVSEEEARAALRTLRLVLQRQGIEFKPPW… |
| A0A7W3NI06 | 10-138 | GDGWARPWVLNVALVESLRFGPAAGHTDLDVAIALTRLLHYDFVCHGTDGKGGHLDDDNVPIVIKAHRSVLERLALEPPAWPFRTFD… |
| A0A5M3WFW4 | 7-137 | None |
| A0A1H0DXJ5 | 10-144 | None |
| A0A1M5NRY8 | 1-121 | None |
| D0L895 | 246-385 | None |
| A0A255HBF0 | 14-139 | None |
| A0A7Y9EQN3 | 1-127 | None |
| A0A4Y8KQ46 | 1-134 | None |
| S4W5P2 | 46-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.