DPCstruct | MC14579
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 222 ± 24 aa |
| Standard deviation of domain lengths | 24.10 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 21.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9B8J5 | 547-793 | SALHSNTYLDGKAELRDGEIADVKINVPRDKVDILEVTSKLFLVGGAPESQELVELRGVVEDKERMRACTPQTLSSLTGMQLCGELS… |
| A0A060Z757 | 25-223 | TIPAPQGPAKLISITNKLFEVTSAGVKPIPSLVEDRIDVSECTPFLAGMKYCTTLQYSDASSHDTAPYFPFTGDSKLAVELHPTGDV… |
| A0A3L8SGQ0 | 77-296 | None |
| F6YF15 | 1-236 | None |
| M3YT50 | 618-811 | None |
| A0A096M975 | 537-736 | None |
| A0A182TTA8 | 172-431 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.