DPCstruct | MC14574
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Standard deviation of domain lengths | 6.27 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6NPB4 | 42-124 | EDFKDIIIQELTWKKFYVHLAGCTGGAHLHIVDLLKQLNQSEVFSPEESDYIVVFCPVRSHIRTDISVALETVPALKPTILVV |
| A0A4W5KY94 | 1-77 | MSGMVRFFIFVVGNTLGAHVDLTRHLVIRGGCTEVMSQEESDVIMAFCPIVSRAGTDIEAALQQIPAGKPIILVVLH |
| G3PEM6 | 3-89 | None |
| A0A484CA63 | 5-82 | None |
| A0A7J5ZS75 | 122-211 | None |
| A0A2D0QCB9 | 1-86 | None |
| A0A6A4RV37 | 2-88 | None |
| A2BHJ8 | 4-84 | None |
| A0A6G0I4Y4 | 171-264 | None |
| A0A556VC61 | 191-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.