DPCstruct | MC14573
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 90 ± 5 aa |
| Standard deviation of domain lengths | 5.31 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 50.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060YVB6 | 1-93 | MCLNGVIDAAVNGGIARYQEAFFDKEYIGSHAEDTEKITSLKDLMQEQVHILGAGLAVHDKLVHPEMRPLHKKLIDQFQMMRSSLYV… |
| M7B7H7 | 1-85 | MCLNGVIDAAVNGGIARYQEAFFDKDYITKHPGDAEKITQLKELMQEQVHVLGVGLAVHEKFVHPEMRPLHKKLIDQFQMMRSSL |
| F6WUP8 | 117-199 | None |
| S4RYL3 | 465-556 | None |
| S9WYG2 | 708-798 | None |
| A0A6I9Z4Q8 | 71-153 | None |
| A0A643CCV7 | 68-163 | None |
| A0A6L5D8I5 | 127-209 | None |
| A0A5N4CKK3 | 639-731 | None |
| H3CYE3 | 317-408 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.